PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000542350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 284aa    MW: 31634.2 Da    PI: 8.6327
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000542350genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA37.72.9e-12100131132
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                    C++Cgt kT+ W  gp g+ktLCnaC+  y++
  MDP0000542350 100 CHHCGTRKTSRWQAGPLGPKTLCNACWCWYKS 131
                    ***************************99986 PP

2GATA39.76.5e-13138168133
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                    C++Cgt +Tp+WRr   g  tLCnaC ++ +++
  MDP0000542350 138 CQHCGTLNTPQWRR--VGRDTLCNACAIKLKHR 168
                    *************6..56899*******99976 PP

3GATA31.72.1e-10176209132
           GATA   1 CsnCgttk.TplWRrgp.dgnktLCnaCGlyyrk 32 
                    C+ C t+k Tp+WR++   g+k LC aC ++y++
  MDP0000542350 176 CQDCETKKsTPQWREDCpKGKKALCDACYVRYKS 209
                    ***************955**************97 PP

4GATA22.51.6e-07216249131
           GATA   1 CsnCgttkTplWRrgp...dgnktLCnaCGlyyr 31 
                    C+ Cg+ kT+ W +++    g+ tLCn C ++y+
  MDP0000542350 216 CQRCGVGKTKPWQNWGegpLGKNTLCNNCHIRYK 249
                    **********99987644478889*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.38E-892131No hitNo description
Gene3DG3DSA:3.30.50.101.4E-893131IPR013088Zinc finger, NHR/GATA-type
SMARTSM004018.4E-594137IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.02794130IPR000679Zinc finger, GATA-type
CDDcd002021.75E-799131No hitNo description
PfamPF003204.2E-10100131IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.936132169IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-8134168No hitNo description
Gene3DG3DSA:3.30.50.102.0E-9137167IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.05E-7137168No hitNo description
SMARTSM004011.4E-4138182IPR000679Zinc finger, GATA-type
PfamPF003201.1E-10138168IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.9E-7174209IPR013088Zinc finger, NHR/GATA-type
PfamPF003203.3E-9176209IPR000679Zinc finger, GATA-type
SMARTSM004010.0013210264IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-5212251No hitNo description
Gene3DG3DSA:3.30.50.105.1E-4213251IPR013088Zinc finger, NHR/GATA-type
PfamPF003203.3E-6216249IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MHANSPVPGS VNSRLVWRPA WAGCQAIERA GEECSEEVLE WLSNKDAFPP VETFFGIDLS  60
FAGIPWEGEQ LSTNQSDNSG KDDMTKAETP MMAKTVGRQC HHCGTRKTSR WQAGPLGPKT  120
LCNACWCWYK SVMIGGKCQH CGTLNTPQWR RVGRDTLCNA CAIKLKHRSE ILRRKCQDCE  180
TKKSTPQWRE DCPKGKKALC DACYVRYKSD IIGRKCQRCG VGKTKPWQNW GEGPLGKNTL  240
CNNCHIRYKV EINGRKCQHA GLETPCDGAQ VPLERTPCVT TVG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2774523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.13e-11GATA transcription factor 1